PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 628aa    MW: 72488.5 Da    PI: 6.1237
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625360.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.81.7e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++gkk+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v 
  XP_009625360.1   6 LPPGFRFHPTDEELVAYYLKRKINGKKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVN 99 
                     79****************************.99***************6434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s + + vg+kktLv+y+grap+g +tdWvmheyrl
  XP_009625360.1 100 S-EMRSVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                     9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-624155IPR003441NAC domain
PROSITE profilePS5100560.9536156IPR003441NAC domain
PfamPF023655.6E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING KKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS EMRSVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDEGECEV SNGLQDGYAL CRVIKRSLNG PKKGDDVNYG SDRSSEGRCD  180
HHHMEMPSSF ATPTPSDDNW NMQYLSNQPF AFNNTTHPIP NYGTLPYPPS KVNIALECAR  240
LQHRFALPPL EIQDFPQVGY VDTKMPQSSF IQSTNQTDIV EEILSVAQAS QNLINQDLSW  300
GGNSCAPVDN FSFLPPNNNQ IHDLDSFHFI EQLKEDQNVR SIGIGDFGED FKSDRMVENL  360
RWIGMSDRDL EKTFLEDYKT VPIENVSAIQ REENQFQGEY SGHHNNLSGF NETETNNFSI  420
GFGNDKLLDD GNMTDGLSNS PSFEVYEKIE VNHGFFIATR QTAKTFYHQL TPSTTLRIHR  480
NLVTVHDLPL YIGKFSDSIA IPKERNFYDN FVKKVTRPWT TTMRTLVSMV AFLHTFFWIC  540
FGECLDEKGS QLEDKRGVSV NEECLMEREE KKKAQDYKWD YCYKQNKFPI VDKEEEKYCN  600
VAVEKKWPYL TLVVALSTIW LHHIVPSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-54116212171NO APICAL MERISTEM PROTEIN
1ut4_B3e-54116212171NO APICAL MERISTEM PROTEIN
1ut7_A3e-54116212171NO APICAL MERISTEM PROTEIN
1ut7_B3e-54116212171NO APICAL MERISTEM PROTEIN
3swm_A3e-54116215174NAC domain-containing protein 19
3swm_B3e-54116215174NAC domain-containing protein 19
3swm_C3e-54116215174NAC domain-containing protein 19
3swm_D3e-54116215174NAC domain-containing protein 19
3swp_A3e-54116215174NAC domain-containing protein 19
3swp_B3e-54116215174NAC domain-containing protein 19
3swp_C3e-54116215174NAC domain-containing protein 19
3swp_D3e-54116215174NAC domain-containing protein 19
3ulx_A3e-54213311140Stress-induced transcription factor NAC1
4dul_A3e-54116212171NAC domain-containing protein 19
4dul_B3e-54116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265096e-86AC226509.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0144P17, complete sequence.
GenBankHG9754416e-86HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755146e-86HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625360.10.0PREDICTED: uncharacterized protein LOC104116251
RefseqXP_016489725.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLK4B9Z70.0K4B9Z7_SOLLC; Uncharacterized protein
STRINGSolyc02g081270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-141NAC domain containing protein 28